PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02285.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 359aa    MW: 40462.5 Da    PI: 6.8568
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02285.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10134191562
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Rsa1.0_02285.1_g00005.1 134 KRAKRIMANRQSAARSKERKARYIMELERKVQSLQTEATTLSAQLSLFQRDTTGLSSE 191
                              9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-16130194IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783132195IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9134192IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-10134185No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-8134180No hitNo description
CDDcd147033.30E-23135184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MDDPSNTKPN QCPPLSTPAP SSTPFRGPYH RRAHSEVHFR LPEDLDLSEP FGGFDELGSE  60
DDLFCSYMDI ENKLGSGSDS AGPSAAPRSE AENSRPRHRH SLSVDGGSST LESIEAKKAM  120
APDKLAELWV VDPKRAKRIM ANRQSAARSK ERKARYIMEL ERKVQSLQTE ATTLSAQLSL  180
FQRDTTGLSS ENTELKLRLQ VMEQQAKLRD ALNDQLKKEV ERLKFATGEV SHADAYNLGM  240
AHMQYSQQQQ QPQQQQQSFF QHHHHHHHQQ QQQQTDAQNM QQMTHQFHLF QPNNNNHNHN  300
QNPQLMHHAT SNASGQSHSF AEAMHEDHLG RLQGLDISSC GRGSNFGRSD TVSESSSTM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742691e-155AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967461e-155AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860931e-155Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634112.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P47e-95RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D3C5G70.0A0A0D3C5G7_BRAOL; Uncharacterized protein
STRINGBra016980.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-132bZIP family protein